PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004493571.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 336aa    MW: 39289.2 Da    PI: 7.3966
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004493571.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like77.51.7e-24205259155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k r+rWt+eLHe F+  v++LGG+e+A Pk+il++m+ + L+++h+kSHLQk R+
  XP_004493571.1 205 KRRVRWTKELHEPFMMIVNHLGGPERAKPKAILDMMNSDLLSISHIKSHLQKCRS 259
                     68**************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.384202262IPR017930Myb domain
SuperFamilySSF466891.08E-12203260IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-22203261IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-19205259IPR006447Myb domain, plants
PfamPF002491.8E-5207257IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MYQHWSRMFG TQWESYMGIN NLVKVVESEQ VNFEPIKSSP CNNIVTTTNL QTPHVSFQAT  60
EEYYDEDQIE VPDWSCFEFP KITDPPMLIC QTSGDNFNSD QITNSLYSVD ESLLSNSSDS  120
HCSEEEYSNF QSGNNITFYD HFPHKHDELL RSDASKDERP LEISFQRSKS WRGSCTKSEK  180
QSPQLYGIAC VTSSNSSTRK VHKSKRRVRW TKELHEPFMM IVNHLGGPER AKPKAILDMM  240
NSDLLSISHI KSHLQKCRST TRFHKPLQEK SEEGHRIDGV TELQHKIQMQ IEESRQLQIE  300
IRKSISQQLK MQRNLQTLIE QERKKLKLML DIQRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004493571.10.0PREDICTED: uncharacterized protein LOC101503480 isoform X2
TrEMBLG7KVB91e-145G7KVB9_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
STRINGGLYMA03G29935.11e-115(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.12e-29G2-like family protein